Stimulates the ATPase activity of several Hsp70-type chaperones. Plays a role in the diphthamide biosynthesis, a post-translational modification of histidine which occurs in translation elongation factor 2 (By similarity).

Belongs to the DPH4 family.

170 amino acids

MTNSSNNSNKCENKNYYEILKVSIDADIEEIKKSYRKLALLYHPDKLNKEENIEENINNFSNCLVNNNNNNNNSNTKDFNDIQIAWETLKDDLLRKQYDSLLLEQKRQKYSVSDEIDLDDMEFIEENSEYVYPCRCGDHYIITEDQLSEGSDVVCCSGCSLSIKVIYQME

19.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make dph4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here