Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits.

Belongs to the RNA polymerase subunit omega family.

97 amino acids

MSTPNALAAFNSSPSLNAPEGITNPPIDDLLEQVSSKYALVIYSAKRARQINDYYAQLGEGLLEYVGPLVEPGPREKPLSIALREIHAGVLEHTEGE

10.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rpoZ using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here