Protein expression services for NRPE5A | DNA-directed RNA polymerase V subunit 5A
Description
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase V involved in RNA-directed DNA methylation-dependent (RdDM) silencing of endogenous repeated sequences, including transposable elements. Required for establishment of DNA methylation.
Family
Belongs to the archaeal RpoH/eukaryotic RPB5 RNA polymerase subunit family.
Species
Arabidopsis thaliana
Length
222 amino acids
Sequence
MEVKGKETASVLCLSKYVDLSSEESHRYYLARRNGLQMLRDRGYEVSDEDINLSLHDFRTVYGERPDVDRLRISALHRSDSTKKVKIVFFGTSMVKVNAIRSVVADILSQETITGLILVLQNHVTNQALKAIELFSFKVEIFQITDLLVNITKHSLKPQHQVLNDEEKTTLLKKFSIEEKQLPRISKKDAIVRYYGLEKGQVVKVNYRGELTESHVAFRCVW
Mass
25.6 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make NRPE5A using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here