DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Essential for tRNA synthesis. The RPC53/RPC4-RPC37/RPC5 subcomplex is required for terminator recognition and reinitiation (By similarity).

330 amino acids

MRKFTPKFVPRRKNGPVEEKDVDERVKIEFDVESQKKWKASRPKPEIKLTASGPFALGPNASSSGTGRPIGSVYVPPPNVKNEEKDDALSKLAASSGHDEGHDEDMVDILKLRELNGQEQGKTDIGGKDLLVPIITDRMLPESNDEKLKHHAESAIHTTVINKEDEEQERVALDLQSLAQHLGLTEQEGMEDHFKDQMVLMQFPDKLPRFMGDADVDPVWPSSEVKEEEAGEKTDVEEKKDPDKHGRENGNIDDLTSLPYPAFHPPAGQIGVLRVHQSGKTTLEMGGVNFVVQSGSDCLFLQEIAVVDYDSKRIWNLGSFERRMIVSPDF

36.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rpc53 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here