Protein expression services for devR | DNA-binding transcriptional activator DevR/DosR
Description
Member of the two-component regulatory system DevR/DevS (DosR/DosS) involved in onset of the dormancy response. Regulates an approximately 48-member regulon (PubMed:12953092). When phosphorylated binds and activates the promoter of DevR regulon genes in response to hypoxia (By similarity). Accepts a phosphate group from DevS (DosS) and from DosT (By similarity). Does not regulate transcription of dosT (By similarity).
Species
Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Length
217 amino acids
Sequence
MVKVFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAMARVPAARPDVAVLDVRLPDGNGIELCRDLLSRMPDLRCLILTSYTSDEAMLDAILAGASGYVVKDIKGMELARAVKDVGAGRSLLDNRAAAALMAKLRGAAEKQDPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQAAVFATELKRSRPPGDGP
Mass
23.3 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make devR using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here