Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions.

Belongs to the bacterial histone-like protein family.

91 amino acids

MNKSELIQAIADEAELSKRAAAEFVNAFVSVVTQELKDGNDVTLVGFGTFHAAQSAERQGRNPKTGEPLTIAARKTPKFRSGKALKDAVNG

9.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make hupB2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here