A DNA-binding protein implicated in transcriptional repression and chromosome organization and compaction. Binds in the minor groove of AT-rich DNA (PubMed:21673140). Binds nucleation sites in AT-rich DNA and bridges them, forming higher-order nucleoprotein complexes and condensing the chromosome. As many horizontally transferred genes are AT-rich, it plays a central role in silencing foreign genes (By similarity).

Belongs to the histone-like protein H-NS family.

112 amino acids

MPVQGRENMDPKSPGYLALIAQRESLDAQIIAARKAEREVAIGQIKALMKEFDLSVLDLQERVQKRNSKRMSTVPKYRDPATGKTWSGRGRQPAWLGNDPAAFLIQPDLPAI

12.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Bcep1808_6219 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here