About Products Protein Database Contact

Protein expression services for albA2 | DNA/RNA-binding protein Alba 2

Description
Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes (By similarity).
Family
Belongs to the histone-like Alba family.
Species
Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Length
90 amino acids
Sequence
MTVKKPNEILISRTKRVEDYVLDVIVMFNQGYDEVELKGVGNSIYKAVEVYNQLKDRLGDGIILEKADIGSEVKDRRRISYISIKLKRVY
Mass
10.4 kDa
Simulated SDS-PAGE
Western blot of albA2 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make albA2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here