Required for the use of extracellular DNA as a nutrient (PubMed:16707682). Has been suggested to be involved in gluconate metabolism (PubMed:9871335).

Belongs to the ComF/GntX family.

227 amino acids

MLTVPGLCWLCRMPLALGHWGICSVCSRATRTDKTLCPQCGLPATHSHLPCGRCLQKPPPWQRLVTVADYAPPLSPLIHQLKFSRRSEIASALSRLLLLEVLHARRTTGLQLPDRIVSVPLWQRRHWRRGFNQSDLLCQPLSRWLHCQWDSEAVTRTRATATQHFLSARLRKRNLKNAFRLELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAAAVQVWCLCRTL

25.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gntX using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here