Description
Essential cell division protein that coordinates cell division and chromosome segregation. The N-terminus is involved in assembly of the cell-division machinery. The C-terminus functions as a DNA motor that moves dsDNA in an ATP-dependent manner towards the dif recombination site, which is located within the replication terminus region. Required for activation of the Xer recombinase, allowing activation of chromosome unlinking by recombination (By similarity).
Family
Belongs to the FtsK/SpoIIIE/SftA family.
Species
Clostridium tetani (strain Massachusetts / E88)
Sequence
MAKKKKQKTIKLDAEIKGILFITIGVLSLISIMSSSNSGIIGKMSKKILVFIFGLGAFIFPFFIIFVGVCLILKKGKVTYSGKFYGIVLFILNTLFCLHIGDIVTKGLDRSFFQGIVDIYNSETFLHGGVISYIVDLPLYKLFGKWGTFVIFISIYVICFILISQISLYSIISKFKLKKEKRRKEKNIEIKEDVQDEVKFTEIKDSEEIPEEKIINRIKIIDFIKNTNIEENDDTKENKPIQKGKDSNNIQGEKDINKELEEEMSKAALKTIDYEFPSIDLLNDNKSIKLKKEDKKELLNNANKLEETLTSFGVEAKVTQVTKGPSVTRFELQPSVGVKVSKIVHLADDIALNLAAQDVRIEAPIPGKSAVGIEVPNRELTPVYLKEVLDSNEFKNCNKNLAFAIGKDIAGNCVVSDLSKMPHLLIAGATGSGKSVCINTLIISLIYKYSPEDVKLLMVDPKVVELNIYNDIPHLLIPVVTEPKKAAGALYWAVNEMTRRYKLFAETNVRNIESYNELLKKGKGVEKLPLIVIVIDELADLMMVCPNDIEDYIGRLAQMARAAGMHLVIATQRPSVDVITGVIKANIPSRISFAVSSQIDSRTILDMGGAEKLLGKGDMLFYPSGESKPMRVQGAFISEEEVEKVVGFIKEKQCGEVEYEDSIIDEINTSIEINNEDRDELLEEAIKIVVDVDQASTSLLQRKLRIGYNRAARIMDQMEERGIISQKDGSKPRQVLISKDDIV
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service