Essential cell division protein that coordinates cell division and chromosome segregation. The N-terminus is involved in assembly of the cell-division machinery. The C-terminus functions as a DNA motor that moves dsDNA in an ATP-dependent manner towards the dif recombination site, which is located within the replication terminus region. Required for activation of the Xer recombinase, allowing activation of chromosome unlinking by recombination (By similarity).

Belongs to the FtsK/SpoIIIE/SftA family.

787 amino acids

MKDFYQYFQFLFFFMLSVISFSLFVALTPLSNVFVFFVFNLLGQILLNVFSFLSFYLIVYPIVNWYAYKKHIFTKRFIFNWNYTVILFFTLIFLIKINSNVEKSYFIKIFLINFGIVLGNFFIFTLLILEFVVWIYLNYVFFKDVNFILDTFKFLEFKIKILFENILSYFPFSNSLDVKKDIKVYGDSVDDLKDSQVFDEKKNIINDEEYQALWSFSAFLRNNKKPSNINLDKTIFEGSDLKEASSLNKDILNENALNLDENVDEIDESCEYKYLDNLEDNKLVISGKVKACEIRTKGIISQVAISHVYNENVALNKKNDSYVIDISVFDQKEIKNDVEDIEYDKEIQKQSMILQETLKEFNINAKLIDIIKGPVVTMYAVRPDKGIKLSKITSISDNIALRLAAIRVRIIAPIPGREAVGIEIPNKRREFILISEIIDSKEFRGDFRIPFALGKEISGENIVFDLVNSPHLLIAGATGAGKSVCVNSLIASIIFSKSPDEVKLIMIDPKIVELKLFNDIPHLLTPVITDVKRALEALRWCLDEMERRYVLLDNLLVRDISSYNKKIKDENLNLMILPYLVIIIDEFADLILSARKDLENLISRLAAMARAVGIHLVLATQRPSVDVITGVIKANFPSRISFMVASSMDSRIILGSSGAEKLLGKGDMLYISSLNPFPXRIQGGFLKEREVYRLVEEVKKFGSPNYIDDEIFIDSVKEPDLVALGPSDEPMFDEALEIVKTTRKASASYLQRRLKIGYNRAARIIEIMEDMGYVGPVNGSKPREVLI

90.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ftsK using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here