Dioxygenase that repairs alkylated DNA and RNA containing 1-methyladenine and 3-methylcytosine by oxidative demethylation. Can also repair alkylated DNA containing 1-ethenoadenine (in vitro). Has strong preference for double-stranded DNA. Has low efficiency with single-stranded substrates. Requires molecular oxygen, alpha-ketoglutarate and iron (By similarity).

Belongs to the alkB family.

278 amino acids

MDRFLVKGAVGSLKRRMEQEQTGGGPAGLAEEEGNSKKNPRRAAPGNGVDSAGLTWGRIRAEGLNCDYTILFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDTGLTYTFSGLTLSPKPWIPVLERVRDRVSLVTGQTFNFVLINRYKDGQDHIGEHRDDERELALGSPIASVSFGACRDFVFRHKDSRGKHPSRRLEVVRLQLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILPTTKRTTLLTASASVGSFALHS

31.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ALKBH2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here