Very low-fidelity DNA ligase that seals, during DNA repair, nicks in double-stranded DNA. Together with the viral repair DNA polymerase X, fills the single nucleotide gaps generated by the AP endonuclease. It is not essential for viral replication and recombination.

Belongs to the ATP-dependent DNA ligase family.

419 amino acids

MLNQFPGQLSNNVFCFPPIESETKSGKKASWIICVQVMHHNTILPITDEMFSTDVKDAVAEIFTKFFVEEGAVRISKTTRVTEGKNLGKKNATTVVHQAFKDALSKYNRHARQKRGAHTNRGMIPPMLVKHFNIIPKTFFEDETDPIVQRKRNGVRAVACQQGDGSILLYSRTEKEFLGLDNIKKELKQLYLFIDVRVYLDGELYLHHKPLQWIAGQANAKVDSSELHFYVFDCFWSDQLQMPSNKRQQLLTNIFKQKEDLIFIHQVENFSIKDEDEALRLKTQFIKEGYEGAIVRNANGPYEPGYNNYHSPHLAKLKPLLDAEFILVDYTQGKKGKDLGAILWVCELPNKKRFVVTPKHLTYADRYALFQKLTPALFKKHLYGKELTVEYAELSPKTGIPLQARAVGFREPINVLEII

48.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Ken-112 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here