Involved in DNA double-strand break (DSB) repair (PubMed:22135300). Acts probably with HerA to stimulate resection of the 5' strand and produce the long 3' single-strand that is required for RadA loading (By similarity). Processes linear dsDNA probes with 3' or 5' single-stranded overhangs or blunt ends (PubMed:22135300).

Belongs to the NurA family.

339 amino acids

MIRKIYDKLVESHNEIKNQIYNIANYLKQEIQDKVNEYWNEYVINHEQSETCKFVAIDGGSFGRPMRIGIVYAVGAESVIGDNKGVKTLSEDGQIGIFKPGNDAQERISLLMEALELSLALRDGSKGDYILMDGSLSKKIGNKVDIQQFSDEELKLIRNVDLNGIISIKDERKMRDLLMLLNQFLVSKIIEEYDGNVLWISKVSRGRDLFGTDYPDITVLELFTEKRGFSKLIIKNIDIEKISEIPEIEVLRKMEYTTFYTRLDNGKRVIRVDIVGRVDEKIVKEIMDRLSGVSIKGYPFPLLKAHMDVRFSAMDREKIIKLVGSKLHKDIEWWPSQFY

39.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make nurA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here