Protein expression services for ddrC | DNA damage response protein C
Description
Appears to contribute to D.radiodurans capacity to survive exposure to ionizing radiation. May play a role in DNA repair and genome reconstitution.
Species
Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Length
291 amino acids
Sequence
MGTGDPSPLASQGPLPLVEGQKMKKPPPVRRGMNEAMEDRGSFFMALVSAYALHLARPFPALALAAGYLFVEGEDGCVAPRFAFLNGAGGHGVDVGQPQQFGARQAVAGGLDAAFLTYRRAVLAKDGAVADAAELTVDPALATVPGDGGEQFAPGASAFQSGSEPAPGVRLGVALGNLGSHAHVALHGAGEQLPRPLLPAPGFGGVEGEGKRHEIGHAHGGLGSGAEVAVRLGQAVFDQRRFPALGEPELLLGGGGVKQTVRADRQPHGAEIEGQRSVLHTDILAQIMFLT
Mass
29.8 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make ddrC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here