About Products Protein Database Contact

Try expressing rad25 in cell-free | DNA damage checkpoint protein rad25

Description
Required for the DNA damage checkpoint that ensures that DNA damage is repaired before mitosis is attempted.
Family
Belongs to the 14-3-3 family.
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Length
270 amino acids
Sequence
MSNSRENSVYLAKLAEQAERYEEMVENMKKVACSNDKLSVEERNLLSVAYKNIIGARRASWRIISSIEQKEESRGNTRQAALIKEYRKKIEDELSDICHDVLSVLEKHLIPAATTGESKVFYYKMKGDYYRYLAEFTVGEVCKEAADSSLEAYKAASDIAVAELPPTDPMRLGLALNFSVFYYEILDSPESACHLAKQVFDEAISELDSLSEESYKDSTLIMQLLRDNLTLWTSDAEYNQSAKEEAPAAAAASENEHPEPKESTTDTVKA
Mass
30.4 kDa
Simulated SDS-PAGE
Western blot of rad25 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Cell-Free protein synthesis
Have you tried producing rad25 in a cell-free protein expression systems? We have solved cell-free protein expression scale-up and purification challenges so that you can obtain up to low-milligram quantities of proteins in hours.

Order Here