This is one of the five types (D1 to D5) of receptors for dopamine. The activity of this receptor is mediated by G proteins which inhibits adenylyl cyclase. In Xenopus D2R is involved in the regulation of the melanotrope cells of the intermediate pituitary during background adaptation of the animal.

Belongs to the G-protein coupled receptor 1 family.

single

345 amino acids

EWRFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISVVWVLSFAISCPLLFGLNNTASTVCIIDNPAFVIYSSIVSFYVPFIVTLLVYVQIYIVLRKRRKRVNTKRNSHGVGVDAHKDKCTHPEDVKLCAVFVKSNGSFPAEKKKVEAGNHPEDMEMEMMSSTSPPEKTKHKSASPEHQLAVPATSNQCNNVNLPTPVNSPYKAENNGHSKDSTQPAKVFEIQSMPNGKTRTSIKTMSKRKISQHKEKKATQMLAIVLGVFIICWLPFFITHILNMHCNCNIPQALYSAFTWLGYVNSAVNPIIYTTFNVEFRKAFIKILHC

39 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make drd2-b using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here