Description
This is one of the five types (D1 to D5) of receptors for dopamine. The activity of this receptor is mediated by G proteins which inhibits adenylyl cyclase. In Xenopus D2R is involved in the regulation of the melanotrope cells of the intermediate pituitary during background adaptation of the animal.
Family
Belongs to the G-protein coupled receptor 1 family.
Sequence
MDPQNLSMYNDDINNGTNGTAVDQKPHYNYYAMLLTLLVFVIVFGNVLVCIAVSREKALQTTTNYLIVSLAVADLLVATLVMPWAVYMEVVGEWRFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISVVWVLSFAISCPLLFGLNNTGSKVCIIDNPAFVIYSSIVSFYVPFIVTLLVYVQIYIVLRKRRKRVNTKRNSRGVAVDAHKDKCTHPEDVKLCSVFVKSNGSFPADKKKVILVQEAGKHPEDMEMEMMSSTSPPEKTKHKSASPDHNQLAVPATSNQCKNASLTSPVESPYKAEKNGHPKDSTKPAKVFEIQSMPNGKTRTSIKTMSKKKLSQHKEKKATQMLAIVLGVFIICWLPFFIIHILNMHCNCNIPQALYSAFTWLGYVNSAVNPIIYTTFNVEFRKAFIKILHC
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service