Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). May act by forming a heterodimer with NCS6/CTU1 that ligates sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position.

Belongs to the CTU2/NCS2 family.

404 amino acids

MCSIGEDDFGDEGAAHAMVVEALPLGIVLSPGNCSKCDVNSGELYKLNFRAAECRECFLTYARHKFRAALGAAKILPRNAEVLLVLDGSAKSLVLLDMLHFAQTQNQFKRLHCNARVVYVEEQQVQDRDPVDLEALLSLSVQYAPFDFYVIELGQGCSLQRIKDYSPSLKANNELIHKLQKLQSLTARQDYLQQQRKNLICSVAQSLQCTHVFEPNISVDLATQLLTAIALGRGASAALDVALLDDRLSGDVKLLRPLKDLSEQEIQFYIHAQRLKPLFQSGSHYGMERGPTASLQNLTSAFVANLQHNYASTVSTVFRTGDKIAVNSDPEQATCVHCQSALDSELSDTLLAIEYSRSVSEAGVSLYKNGQDLESLAKKRLEMQDGLCHACRAIQAELESGNLL

44.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GG21627 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here