Plays an important role in the cytoplasmic envelopment of tegument proteins and capsids during the assembly and egress processes. Participates also in viral entry at the fusion step probably by regulating the core fusion machinery.

Belongs to the herpesviridae cytoplasmic envelopment protein 3 family.

84 amino acids

MGQAVSYLTYTLRRCCKKNTLTTESGEVIELDDEHYDTVDLDDLRCSDPLMQPKFVLLKNGRRGKRNREYDNDHEKYVMMFNKE

10 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make MDV023 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here