Heme chaperone required for the biogenesis of c-type cytochromes. Transiently binds heme delivered by CcmC and transfers the heme to apo-cytochromes in a process facilitated by CcmF and CcmH.

Belongs to the CcmE/CycJ family.

168 amino acids

MTRKQRRLMLIGVCGAVLAVALGLVLWAMRGTIVFFRSPSEIASQAVAPGVRFRLGGLVQEGSVQRGPDGRVAFVVTDNGATVPVRYQGLLPDLFREGQGVVAEGMLEPGGMFRADTVLAKHDETYMPREVADALKKQGHWQGEAKHPGGTAPAPQTASGEKPALRQQ

18 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ccmE using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here