Functions as an electron carrier between membrane-bound cytochrome b6-f and photosystem I in oxygenic photosynthesis.

Belongs to the cytochrome c family. PetJ subfamily.

111 amino acids

MKRILGTAIAALVVLLAFIAPAQAADLAHGGQVFSANCAACHLGGRNVVNPAKTLQKADLDQYGMASIEAITTQVTNGKGAMPAFGSKLSADDIADVASYVLDQSEKGWQG

11.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make petJ using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here