Involved in cytochrome c oxidase complex assembly and is required for efficient formation of respiratory supercomplexes comprised of complexes III and IV.

Belongs to the cytochrome c oxidase subunit 6B family.

90 amino acids

MAGNGALRRSAREKCWEARDAYFGCLDRHSILDGLKDDTKAAQACSAEKTAFETDCVKSWVNYFLKFRVQQHQQQEAIKKLEAQGAKKLN

10.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make new16 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here