About Products Protein Database Contact

Protein expression services for MT-CO2 | Cytochrome c oxidase subunit 2

Description
Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1 (By similarity).
Family
Belongs to the cytochrome c oxidase subunit 2 family.
Species
Phyllostomus hastatus
Length
227 amino acids
Sequence
MALPFQLGFQDATSPIMEELLHFHDHTLMIVFMISSLVLYLISSMLTTRLTHTSTMDAQEVETIWTILPAIILITIALPSLRILYMMDEINNPSMTIKTMGHQWYWSYEYTDYSELCFDSYMIPTSDLKSGGLRLLEVDNRVVIPMEMTVRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQTTLLSTRPGLYYGQCSEICGSNHSFMPIVLEMVTLNCFEKWSTSML
Mass
25.9 kDa
Simulated SDS-PAGE
Western blot of MT-CO2 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make MT-CO2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here