About Products Protein Database Contact

Protein expression services for cyoB | Cytochrome bo(3) ubiquinol oxidase subunit 1

Description
Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).
Family
Belongs to the heme-copper respiratory oxidase family.
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Length
658 amino acids
Sequence
MFGKLTLSAVPYHEPIVMVTLAVVALLGLGVVGAITYYRKWTYLWTEWLTSVDHKKIGVMYIVVALVMLVRGFADAIMMRGQLALAEGANHGYLPPEHYDQIFTAHGVIMIIFMAMPFMTGLMNLAVPLQIGARDVAFPFLNSLSFWLLVVSAMLVNVSLGLGEFARTGWVAYPPLSELAYSPGVGVDYYIWALQISGMGTLLTGINFLVTVFKMRTPGMKLMQMPIFTWTCTFANILIVASFPILTAALGLLSLDRYLDMHFFTNELGGNAMMYINLFWAWGHPEVYILILPAFGIFSEVTATFAGKRMFGYKSMVWASAAITFLGFTVWLHHFFTMGSGGDVNGFFGVATMLISIPTGVKLFNWLFTIYKGRLRFSTPILWTLGFMVTFTIGGMTGVLLAIPGADFLLHNSLFLIAHFHNTIIGGAVFGYLAGFAFWFPKAFGFTLDEKWGKRSFWCWLVGFYMAFMPLYILGFMGMTRRLNHYDNPLWKPYLVVAFFGAVLIFCGIACQLIQLFVSVRNRKQLADVNGDPWEGRTLEWATSSPPPFYNFAELPKVQDVDAFHDMKKAGTAYRKLPAYQPIHMPKNTAAGFSIAVFAFVFGFAAIWHIWWLMAVGFVGMIGSFIVRSYNQDVDYYVQPEEIEKIESARFQQLAKQV
Mass
73.9 kDa
Simulated SDS-PAGE
Western blot of cyoB recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make cyoB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here