The cytochrome b6-f complex functions in the linear cross-membrane transport of electrons between photosystem II and I, as well as in cyclic electron flow around photosystem I.

Belongs to the petO family.

203 amino acids

MALATRCKAPAAVCAAHSRRSVKVSAHKGAFEQVQVAAAAVAAAALLASPANAGVVLQQPELKKVFQDDAPAPAPVKREFKGLAPPSLPKPVEAPKPAAVAAAPEKKEEVKESGSDLDPRSIALPGALALTIGGFFAASKIDTSFNEWFIEAVVKDSNNYAGYEATLKTDAGVVFPKAATAGTKKVKAATGSKKGGFPFGGKK

20.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PETO using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here