Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Belongs to the cytochrome b family. PetD subfamily.

160 amino acids

MSILKKPDLSDPILRQKLAKGMGHNYYGEPAWPNDLLYMFPVVILGTIACLTGLAVLDPALVGEPADPFATPLEILPEWYLYPVFQILRIVPNKLLGIVLQSMIPLGLIAIPFIESVNKFQNPFRRPIATAVFLFGTVFTLYLGIGAALPIDKSLTLGLF

17.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make petD using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here