Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. Associates with NOX3 to form a functional NADPH oxidase constitutively generating superoxide.

Belongs to the p22phox family.

194 amino acids

MGQIEWAMWANEQALASGLILVAGGIVATAGRFTQWYFGTYAIAAGVLVCLLEYPRGSRAKGSTLERCGQRYLTAVLKLLGPLSRNYYFRAALHLALSVPAGFLLATILGTVCLVIASIIYLLAAVRGEQWTPIEPRPKERPQVGGTIKQPPSNPPPRPPVEARKKPGEEDATPAGGPPGGPRVNPIPVTDEVV

20.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make CYBA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here