Description
Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) that is part of the mitochondrial respiratory chain. The b-c1 complex mediates electron transfer from ubiquinol to cytochrome c. Contributes to the generation of a proton gradient across the mitochondrial membrane that is then used for ATP synthesis.
Family
Belongs to the cytochrome b family.
Sequence
MASLRKTHPLLKIANDALVDLPSPANISVWWNFGSLLGLCLASQILTGLFLAMHYTPDVESAFNSVAHICRDVNFGWLIRNMHANGASFFFICLYLHIGRGLYYGSYLFVETWNVGVVLLLLVMMTAFVGYVLPWGQMSFWGATVITNLLSAVPYVGTTLVEWIWGGFSVDNATLTRFFAFHFLFPFVILAAAVLHLLFLHETGSNNPIGLNSNADKISFHPYFTYKDLLGFAVLLMGLTSLALFSPNLLGDPDNFTPANPMVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALLASILILMVVPFLHTSKQRALTFRPASQFLFWTLVADVVVLTWIGGMPAEQPFIIIGQVASVLYFSLFLVLFPLAGWAENKVLGWT
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service