Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) that is part of the mitochondrial respiratory chain. The b-c1 complex mediates electron transfer from ubiquinol to cytochrome c. Contributes to the generation of a proton gradient across the mitochondrial membrane that is then used for ATP synthesis.

Belongs to the cytochrome b family.

390 amino acids

MTFRKSNVYLNLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQILTGIFMAMHYSSNIELAFSSVEHIMRDVQGGWFLRYAHANGASFFFICMYIHMGKALYYGSYRSPRVLLWTIGVIIFILTMATAFLGYCCVYGQMSHWGATVITNLFSAIPFIGKDIVLWLWGGFAVSNPTIQRFFALHYLFPFVIAAVVIMHMMALHIHGSSNPLGITGNMDRLPMHGYFVFKDLITVFVFLIVFSLFVFFSPNTMGHPDNYIPGNPMVTPASIVPEWYLLPFYAILRSIPDKLMGVITMFSAILVLLVLPFTDRSVVRGNSFKVLSKLFFFLFVFNFVLLGQIGAVHVEVPYILMGQISTFLYFAYFLVFIPIISTIENILFYVGSRNNTDDLK

44.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make COB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here