Cytochromes P450 are a group of heme-thiolate monooxygenases. They oxidize a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.

Belongs to the cytochrome P450 family.

410 amino acids

MNKEVIPVTEIPKFQSRAEEFFPIQWYKEMLNNSPVYFHEETNTWNVFQYEHVKQVLSNYDFFSSDGQRTTIFVGDNSKKKSTSPITNLTNLDPPDHRKARSLLAAAFTPRSLKNWEPRIKQIAADLVEAIQKNSTINIVDDLSSPFPSLVIADLFGVPVKDRYQFKKWVDILFQPYDQERLEEIEQEKQRAGAEYFQYLYPIVIEKRSNLSDDIISDLIQAEVDGETFTDEEIVHATMLLLGAGVETTSHAIANMFYSFLYDDKSLYSELRNNRELAPKAVEEMLRYRFHISRRDRTVKQDNELLGVKLKKGDVVIAWMSACNMDETMFENPFSVDIHRPTNKKHLTFGNGPHFCLGAPLARLEMKIILEAFLEAFSHIEPFEDFELEPHLTASATGQSLTYLPMTVYR

47.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make cyp106 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here