Cytochrome P450 monooxygenase involved in the biosynthesis of culmorin, a tricyclic sesquiterpene diol reported to have antifungal activity and some phytotoxicity to wheat coleoptile tissue, contributing to Fusarium head blight disease (PubMed:19880637). The terpene cyclase CLM1 is responsible for the cyclization of farnesyl diphosphate into the intermediate longiborneol (PubMed:19880637). Longiborneol is then hydroxylated in a regio- and endo-stereoselective manner at position C-11 by the cytochrome P450 monooxygenase CLM2 to produce culmorin (PubMed:26673640). Additional non-specific oxygenases are also able to hydroxylate longiborneol at other sites than C-11 leading to 3-hydroxylongiborneol, 5-hydroxylongiborneol, 12-hydroxylongiborneol and 15-hydroxylongiborneol (PubMed:26673640). Moreover, another oxygenase capable of installing a C-11 exo-hydroxy group in longiborneol can also yield 11-epi-acetylculmorin (PubMed:26673640). The production of these longiborneol derivatives is dwarfed by the high abundance of culmorin, suggesting that CLM2 displays superior enzymatic activity to the unidentified, possibly promiscuous, additional oxygenases (PubMed:26673640).

Belongs to the cytochrome P450 family.

529 amino acids

MLLIIVVLVGTLIYFLSFHNKKRHGLPPGPKPLPIIGNIKDMPPKGVAAFRHWLKHKDTYGPVSSVSVLGQPLILIHDREAAHYLFDKSSGKSSGRPSANFGGRLCGFDQILSLQQYGDTFKRHRKLVHRQMGTRAGAAKFRQIQDVESHRFLLRSLDNPGNLMEHIRKEAGGVILKATYGYSIEPHKPDPLVHLVEFMVEGISIVVVPMKFVVDFLPWLEYIPECLPGMSFKARARRWRTILNNTIEAPYQFVRQQMAKGIQFESYVSSLLTQEKLKGGNDTLDETYEADIKRTAAIMYAGGADTTVSTIQSFVLAMMVYPEVLKKAQAEIDNVIGPDRLPGFEDRENLPYINSMVKESLRWMPAVPMGAAHKADDDIYYGDLCIPKGSFLLPNVWWFLHNPETYQDPERYDPDRYLEPRNEPDPDSNCWGYGRRICPGRLLADESIFIVIARVVAAFDIEKDVDEQGNTIEPKVEFTTEGALSRPVDYPYRIKPRNAKCVDLIRAVEKEHPWDKGDASLLQQDMVVL

60 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make CLM2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here