Required for the promotion of megasporogenesis, or promotion of germ cell formation from somatic precursor cells. Acts redundantly with WIH1. Functions in a genetic pathway downstream of SPL/NZZ and WUS and together with TRN2 in promoting megasporogenesis.

Belongs to the CYSTM1 family.

98 amino acids

MSQYNQPPVGVPPPQGYPPEGYPKDAYPPQGYPPQGYPQQGYPPQGYPQQGYPQQGYPPPYAPQYPPPPQHQQQQSSPGFLEGCLAALCCCCLLDACF

10.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make WIH2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here