Cysteine dioxygenase involved in sulfite formation from cysteine. Required for keratin degradation and plays an important role in filamentous growth and virulence.

Belongs to the cysteine dioxygenase family.

219 amino acids

MPFIENQTTTAEPIVPVDVKGKDAFHKLVDDLSAVLGPSSGLDSDDVDPMDIQKLMEGYVSNHEEWQRYALADESRAYTRNLVDEGNGKSNLLVLVWNPGKSSPIHDHANAHCVMKILHGSLKEHRYDWPEQDKINNGEACPLTVTKETILRENEVAYMSDKLGLHKISNPDPNDFAISLHLYTPPNAAHFGCSLFDEKTGKSHHIKQCTFFSNRGLKL

24.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make CDO1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here