Specifically catalyzes the beta-elimination of phosphate from L-phosphoserine and the beta-addition of sulfite to the dehydroalanine intermediate to produce L-cysteate.

Belongs to the threonine synthase family. Cysteate synthase subfamily.

415 amino acids

MGEYTLRCAGCGNLLIGGAASCPLDGGLPRADYIERRFNPRKLPGIWSFIDWLPVDGWNRSTGASSVTYRSSGLAAELGLDSLYISFSGYWPERGALMRTCSFKELEAAPTMQMLRDRKAGETLVVASAGNTARAFAEVCSITDQPLILFVPVSSLDRIWTTVEPGRVLVVGVKGDYADAIKLADVLSSRSGFRAEGGARNIARRDGMGTVLLDHVRRFNSLPNHYFQAIGSGTGGIAVWEASMRIIEDGRFGERLPRLHLAQNTPCAPVYNMWHGMGSEESDFDAYGCPEGMHDDVLFNRNPPYAVPGGVRDAVISSGERIYGIDNSRAVSAQKLFEMSEGIDILPAASVAVAALVDAVESGFVENDDDILLNITGGGVKRLAEDHSRVKLKCDLTVGLRDSEDALSSIEEIFA

44.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Mthe_0680 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here