May be involved in testis development (PubMed:9826679). May play a role in hematopoietic differentiation or inflammation (By similarity). Has immunomodulatory and antimicrobial functions against Francisella tularensis, a Gram-negative bacteria (PubMed:23922243).

Belongs to the cystatin family.

137 amino acids

MSCPLRKKALPLTMLLLLLSFHVLITPVSKANKETNRSVHFIPTVEFAVNTFNQESQDEYAYRMEHIMSSWREKVNFPTVYSMRLQLRRTICKKFEESLDICPFQESHGLNNTFTCLFTVGTYPWITKFKLFRSVCS

16.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Cst9 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here