Description
May play a role in the last steps of the chondrocyte differentiation pathway as an inducer of maturation (PubMed:13679380). Induces chondrocyte calcification during endochondral ossification by playing a role in the transcriptional inhibition of ENPP1, a generator of pyrophosphate which inhibits calcification (PubMed:16680148). Possibly impairs the binding of a transcription factor to the ENPP1 promoter (PubMed:16680148). Unlike other cystatins, does not have thiol protease inhibitor activity (PubMed:16680148).
Family
Belongs to the cystatin family.
Sequence
MASLLSPSMPVLAAVALTLTLAVIPEASTNAEAKQVVLGGVEPADPKDKEVQKVVKFAVRTYNDMDNDLYLSKPIRLMSASQQVVAGKNYYLKIELGRTTCTKTESNLVDCPFNEQPDQQKRVICNFQINVAPWLNKMSMTNFNCYNF
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service