Catalyzes the conversion of (8S)-3',8-cyclo-7,8-dihydroguanosine 5'-triphosphate to cyclic pyranopterin monophosphate (cPMP).

Belongs to the MoaC family.

161 amino acids

MTQLTHFDTAGQAHMVDVGDKASTHRVAVATGTITMLPDTFALVRDGNAKKGDVLGIARVAAIMATKRTADLIPLCHPIGLTKVAVDFALDEAGSSITCTVRTETRGQTGVEMEALTGVQVALLTIYDMCKAVDRGMVMGNVKLLEKHGGKSGDWVSTPAG

16.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make moaC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here