Nematode cuticles are composed largely of collagen-like proteins. The cuticle functions both as an exoskeleton and as a barrier to protect the worm from its environment.

Belongs to the cuticular collagen family.

372 amino acids

MKNNAKEDYRTFSLTTNYSRQMIYRCVTGLQIGFSLFSFIIVCVALPIMYNHVQNTITYVDREMAYCEVRFLYFYCIKFFSTLQRSNDEAALELQYGKMRMTGNRTARGAYGSGASHGFRPTAYGDEITGAPLETECPGCCIPGPPGPRGSSGTPGKPGLPGNAGKPGMPGTTPNQTCPLNQVREPPPCRPCPKGPPGIKGWPGFPGDVGPPGPPGLKGIDGEDGAPGETGPTGPPGYRGGPGAPGDKGPTPEGDLKEGPPGDEGPPGPIGAPGMPGLPGRNGLTGGQGERGWPGVSGESGEPGYPGPEGPMGGQGPPGEPGVCVCQNVDSILLINPGPQPRIRADDYNSDDGYGGSRGGGDRAGYQGYGRK

38.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make dpy-10 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here