Description
Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction (By similarity).
Family
Belongs to the arthropod CHH/MIH/GIH/VIH hormone family.
Sequence
MSLGLIASRLVAVALVVVVACSTTWARSLEGSSSPVASLIRGRSLSKRANFDPSCAGVYDRELLGGLSRLCDDCYNVFREPKVATECRSNCFYNSVFVQCLEYLIPADLHEEYQAHVQTVGK
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service