Late protein which is a part of a large complex required for early virion morphogenesis. This complex participates in the formation of virosomes and the incorporation of virosomal contents into nascent immature virions. A15 is required for the stability and kinase activity of F10 (By similarity).

Belongs to the chordopoxvirinae A15 family.

97 amino acids

MYIENNSLVLIIPETNSITPQLFTIHDNKPICVCSRYSLIPSKKENVQISYIDNIHMYFRSFKNLYLVNPRNHDIIKVFNFLKNYKWGGNFYLLFNV

11.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FPV180 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here