Key enzyme in heme biosynthesis. Catalyzes the oxidative decarboxylation of propionic acid side chains of rings A and B of coproporphyrinogen III (By similarity).

Belongs to the aerobic coproporphyrinogen-III oxidase family.

317 amino acids

MKQLQDEITQALTKLDGGSEFHEDSWERPEGGGGRSRVLRDGAIFEQAGVNFSEVWGSHLPPSILAQRPEAEGHGFYATGTSLVLHPRNPYVPTVHLNYRYFEAGPVWWFGGGADLTPYYPFAEDAAHFHQTLKLACDEHHPEYYPVFKRWCDEYFYLKHRDETRGVGGLFFDYQDGQGVLYRGPNPKGEAANYSNQVGEPASRDWEDLFSFIQGSGKAFLPAYVPIVERRHGMEYGDRQRNFQLYRRGRYVEFNLVYDRGTIFGLQTNGRTESILMSLPPLVRWEYGYQPEPNSPEAELYDTFLKPQDWSNWTANQ

36.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make hemF1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here