Involved in the biosynthesis of the labdane-type bicyclic diterpene labda-8(17),12(E),14-triene. Catalyzes the conversion of geranylgeranyl diphosphate (GGDP) into (+)-copalyl diphosphate.

Belongs to the terpene synthase family.

549 amino acids

MTARPNPVTATVRSDIPMSDTVVSTTYSEQAAHLVARIDQDGLGSVRPSLYETARVISAAPWLPGEPRRLAYLLDEQAPDGSWGEGPERYRLLPTLSGVEAALAVLRRGATPTETARRLAGAVDRGLAALRALPRSGPWPDTAAAEILVPGLVAKIHEQIARIAEDGTPALDGWRPGPGPALPGGYDEALPAYVAKRYASVGSLPVKFHHTFEGIAGYLPPALIPDVPDLLGSSPAATAARAATASSAPSAGTVAALESVAERYAGSFPEAAPILVFERLWVAAALAHTHLPAAALPTVRRWAADIYDPRGVRGAPGLMKDADDTAMAVLVSSLVGLEHTLEPLDQFHNGSHYDCYIGEDTGSITANAHALQALGGYQRRNPETQHIYGPRTDKLRDWLIDQQRPEGPWPDKWHASPYYATARSVAALTRFGGGHAVTAVETAVTWALDTQRDDGSWGVWGGTAEETAYAVQILLSTSTHRPQHTRALHRAETYLGDSAGSGRHPALWHDKTLYAPDAMIEAEILAARQTLRTRHDLNRRVTTPIHAEK

58.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rmnB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here