About Products Protein Database Contact

Protein expression services for abaA | Conidiophore development regulator abaA

Description
AbaA and wetA are pivotal regulators of conidiophore development and conidium maturation (By similarity). They act individually and together to regulate their own expression and that of numerous other sporulation-specific genes (By similarity). Binds to the sequence 5'-CATTCY-3', where Y is a pyrimidine, making both major- and minor-groove contacts (By similarity). Plays a pivotal role in conidiation by regulating cell cycle pathways and other conidiation-related genes (PubMed:24039821).
Family
Belongs to the TEC1 family.
Species
Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084)
Length
858 amino acids
Sequence
MSSSLYHPRPVLSSQRYTPSPDYLQDARRTYHDNSRLPLRETASNAQSHNFNSMVPCYSSQVGISPSVPASLPAPMIPSQSFECLYRVPTPRNQPRFQQRRPRNEVNPLYFWPAFRQYRNRQAHKDTQKDKGGVWRRPELEDAFVDSVLLMPHMGRRKFSMGGKLHGRNMLISEYIFTICVAILGSKEIFRIDNSNDSIEQMGRKQVSSHMQVVKKFFEDLRCFHFLFPAEEKKEPGSTNSDDYYDEEEQESFKSNPVLTALAEGRVPDVKPNYEYFSQLLALQSLISVRPKTAEVYVSSSEVKFRDEIAYDAQDAPLDTESFPHLNKYNNCDDSPSVLGKDVLLHEYTRSLDRTTSACVKTVTRRWQKDAPEIYETLELPTRDEECLLLEMCATLELHEHARFPSGSELTGFVEVAITNPNLQSHRWKCVTRLTRPSELHSDDKKSSVYTNETGIHRRGCSDSKPDCDCHSRPRQDIHVPFPAVEWASILSMAVQYPDVEHQRKKEKRTKGDDRKNLDRAGSKRKRSEDDGDAASWARRDLTGSDLICKVAMYQELWSCAPDSNRWVRQGIVFWRFNTTNQWYKYNPVFKPAGTSWRWLTVNDPMSRYHQQKALVYPSASMSLDSIMSPTPSINQHMTAAMNETFSSAWDPSVSLAQVPNATATNNGLTLFESFSGGLATPPPTAGLQGSYSGSFDHGMPPSTGVGFIPSTCSTAGESHPGTGHGHSHSAAYYDAQTTLADLKPVMSTVNPYQSPTTSSGLDLSSSLVYDNAECDTGLQGWDMPALDGWSTGAGSGSEWGSHHKVEPSSDQTALWTQSQWAQMAGDRDGSPRPMKRRRGDGIDSHIPPTMTAAAGGW
Mass
96.4 kDa
Simulated SDS-PAGE
Western blot of abaA recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make abaA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here