About Products Protein Database Contact

Protein expression services for Cplx2 | Complexin-2

Description
Negatively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. Positively regulates a late step in exocytosis of various cytoplasmic vesicles, such as synaptic vesicles and other secretory vesicles (PubMed:11163241, PubMed:23345244). Also involved in mast cell exocytosis (PubMed:11163241). Although not essential for development, seems critical for the acquisition of higher cognitive functions in the adult brain (PubMed:12915444).
Family
Belongs to the complexin/synaphin family.
Species
Mus musculus
Length
134 amino acids
Sequence
MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK
Mass
15.4 kDa
Simulated SDS-PAGE
Western blot of Cplx2 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Cplx2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here