Description
Positively regulates a late step in synaptic vesicle exocytosis. Organizes the SNAREs into a cross-linked zigzag topology that, when interposed between the vesicle and plasma membranes, is incompatible with fusion, thereby preventing SNAREs from releasing neurotransmitters until an action potential arrives at the synapse. Also involved in glucose-induced secretion of insulin by pancreatic beta-cells (By similarity).
Family
Belongs to the complexin/synaphin family.
Sequence
MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQEEEERKAKYAKMEAEREAVRQGIRDKYGIKKKEEREAEAQAALEANSEGSLTRPKKAIPPGCGDAAEEEDESILDTVIKYLPGPLQDIFKK
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service