About Products Protein Database Contact

Protein expression services for cobQ | Cobyric acid synthase

Description
Catalyzes amidations at positions B, D, E, and G on adenosylcobyrinic A,C-diamide. NH(2) groups are provided by glutamine, and one molecule of ATP is hydrogenolyzed for each amidation.
Family
Belongs to the CobB/CobQ family. CobQ subfamily.
Species
Dehalococcoides mccartyi (strain CBDB1)
Length
503 amino acids
Sequence
MAKLIMVQGTSSNVGKSILVTALCRIFKQDGYKVAPYKSQNMALNAFVTKEGGEIGRAQAVQAEACGIEPSVDMNPILLKPEADSRSQIIVNGKVDRTISAREYYEYAPLLLDTALAALNRLREKNDIVVIEGAGSPAEINLKQREIVNMRIAKEASAPVLLAGDIDRGGVFASLIGTIDLLEPDERYYIKGYLINKFRGDASLLKPAIDVLEDRTSIPVLGIIPYLRNMAIAQEDSVYLDECKGSLGETDLDIAVIRLPRISNYDDFDALATDGASVRFVSKTAEIGNPDLIIIPGTKSTIPDMEYLEQSGLAETIIKKARKGTHVLGVCGGYQILGKMIYDPHKTESETTELKGLGLLDTETTFEKEKATTQISGQVKFDSGLLSGLAGCAVSGYEIHMGRTRLFSAQPAFHITKTPKGPADYLDGASNAEGTVLGTYIHGIFENAAFRRGFLNAIRRHKGIPERQADYFDRDKEYDKLADIVRASIDMEKIYAILNEGIR
Mass
55 kDa
Simulated SDS-PAGE
Western blot of cobQ recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make cobQ using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here