Catalyzes amidations at positions B, D, E, and G on adenosylcobyrinic A,C-diamide. NH(2) groups are provided by glutamine, and one molecule of ATP is hydrogenolyzed for each amidation.

Belongs to the CobB/CobQ family. CobQ subfamily.

487 amino acids

MKYKSIMLLGTASSVGKSTVAAAFCRYFKKKGYRVAPYKALNISLNSFVTKEGDEIGRAQVVQAEACEIDPKEYMNPILMKPSAGFKTQVIVRGKVHCTMDAYKYKELNKYLKEKAKEAYDDISNDYDLIVLEGSGSCAEINLRETDIANMHTAKIADADVILVADINRGGVFASIVGTIMLLTEEERKRVKGVIINKFRGKREFFEPAMRQIEEIIKIPVLGVMPYFDLDIEEEDSASIKLRKGNGKGIDIAIVRLPHMSNFTDFNSLGRIKDVGIRYAENPKDLENANMIIIPGSKNTIDDLIYLKESGFKEALINESSNGKLIFGICGGYQILGEKIIDSLGVEGDIREEEGLGLLNIVTSFNKEKTTKQVVAFDLEGNEVSGYEIHNGESVPTAKENIWIKEKNGNVLGMNNKEQNVFGTYIHGIFDEGDFGEKLINKLKKELNIEESNEVNYKDYKMSQYDKLCELLEENIDMAYVENLIRS

54.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make cobQ using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here