The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.

Belongs to the adaptor complexes small subunit family.

177 amino acids

MESCPSVKNILVLDSEGKRVAVKYYSDDWPSLSSKQAFEKSVFAKTQKTSARTEAEIVMFDSYFVVYKFIQDLHFFVTGGDEENELILASVLQGFSEAIDYLLRNKVHRRAALENLDLIFLCLDEVVDGGIVLETDAKAILEKVSGHGLEGSGSLTEQKLSSALATAREHFARSIFS

19.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Os01g0838800 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here