About Products Protein Database Contact

Protein expression services for ret2 | Coatomer subunit delta

Description
The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins (By similarity).
Family
Belongs to the adaptor complexes medium subunit family. Delta-COP subfamily.
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Length
240 amino acids
Sequence
MVVLAVSIVNRGGKAIISRQFREMSRVRVESLLSSFPALVSEKSQNTTVESDNVRFVYQPLDELYIVLITNLQSNILQDIDTLHLLSQVVTSICSSLEEREILEYAFEIFTAFDEATSLGYRDNVSLTQIKTYLEMESHEEKIQEIVSRNKEIEATEERKRRIKQLELQKKEAARRAAQNLPSADAYESIGYQTVNTTFATSNVEDESAMESYHAAAKASSAPKAKGMQLGKKKNTSLLY
Mass
27.1 kDa
Simulated SDS-PAGE
Western blot of ret2 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make ret2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here